Description
The Glow Blend is a tri-component lyophilized research blend combining three peptides studied in dermatology, fibroblast biology, and tissue repair literature: GHK-Cu (Copper Tripeptide-1, the glycyl-L-histidyl-L-lysine copper complex), BPC-157 (Body Protection Compound-157, a synthetic 15-amino-acid gastric peptide), and TB-500 / Thymosin Beta-4 (a 43-amino-acid β-thymosin family peptide). The blend pairs a copper-binding tripeptide investigated for fibroblast activation and dermal matrix remodeling with two extensively characterized tissue repair peptides studied for angiogenesis and cell migration. The Glow Blend is intended as a comparative pharmacology research blend for investigators studying combined copper-peptide, pentadecapeptide, and β-thymosin signaling in dermal, fibroblast, and connective tissue preclinical models.
Benefits (Research Focus)
• Copper-peptide research — studied via the GHK-Cu component for fibroblast activation and dermal matrix remodeling
• Collagen synthesis pathway — investigated for combined effects on Type I and Type III collagen expression in fibroblast research models
• Angiogenesis & vascularization — explored via BPC-157 and TB-500 for new blood vessel formation in healing tissue research
• Cell migration & cytoskeletal dynamics — examined for combined fibroblast and endothelial cell migration activity
• Comparative dermal pharmacology — researched for paired-compound vs single-compound endpoint differences in skin and connective tissue models
What Researchers Look At
• Fibroblast activation, collagen Type I/III synthesis, and dermal matrix protein expression
• Glycosaminoglycan (GAG) and proteoglycan synthesis markers in dermal research models
• Angiogenesis markers (VEGF, integrins) and endothelial cell migration assays
• Wound closure rates and dermal repair endpoints in preclinical research
• Copper homeostasis and metal-binding peptide pharmacology in skin biology
Quick Specs
• Form: Lyophilized white-to-blue powder (color from GHK-Cu copper complex)
• GHK-Cu: 50 mg per vial
• BPC-157: 10 mg per vial
• TB-500: 10 mg per vial
• Total Peptide Content: 70 mg per vial
• Quantity: 1 vial
• Appearance: Pale blue to white lyophilizate
• Reconstitution: Bacteriostatic or sterile water (added by the end researcher)
• Purity: ≥99% by HPLC (per component)
• Identity: MS-verified (per COA)
• Storage: Protect from light
Identity Basics
• Compound 1: GHK-Cu (Copper Tripeptide-1)
• Class: Copper-binding tripeptide; glycyl-L-histidyl-L-lysine copper(II) complex
• Sequence: Gly-His-Lys (with Cu²⁺ coordination)
• Formula / M.W.: C14H22CuN6O4, ~402.91 g/mol (copper complex)
• CAS: 49557-75-7
• Compound 2: BPC-157 (Body Protection Compound-157)
• Class: Synthetic pentadecapeptide; gastric juice–derived tissue regenerative peptide
• Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)
• Formula / M.W.: C62H98N16O22, ~1419.55 g/mol
• CAS: 137525-51-0
• Compound 3: TB-500 (Thymosin Beta-4 / Tβ4)
• Class: β-thymosin family; G-actin sequestering peptide; 43 amino acids
• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
• Formula / M.W.: C212H350N56O78S, ~4963.44 g/mol
• CAS: 77591-33-4
⚠️ Disclaimer
- This product is intended for laboratory research use only.
- Not for human or veterinary use.
- Not approved for diagnostic, therapeutic, or medical applications.
- Handle using appropriate laboratory safety procedures and personal protective equipment.
COA Verification Notice: Even if the vial label or product image states a certain concentration, always go by the COA for the true verified value. We reference the COA to determine the verified concentration and purity of each product, regardless of what the label or product image indicates.
Janoshik COA — Third-Party Testing
• Glow Blend Batch COA — October 25, 2025










