LL-37 Nasal Spray 5mg — 10 mL

LL-37 is a human cathelicidin-derived antimicrobial peptide.
It is studied for its broad-spectrum activity against bacteria, viruses, and fungi, as well as its roles in immune modulation, wound repair, and inflammation balance.

 Product Highlights

• Each vial contains 10 mL solution (~100 sprays)
• Each spray delivers 0.1 mL = 100 mcg LL-37
• Total LL-37 Content: 10 mg per vial
• Specialized pharmaceutical-grade nasal solution — designed for comfort and ease on the nose
• Unlike many other nasal sprays, this formula avoids irritation and dryness
• Packaged in Class A, lead-free pharmaceutical glass bottles
• Tamper/Child-Proof Cap + Orifice Reducer for integrity, sterility, and ease of use

Description

LL-37 is investigated for antimicrobial defense, immune regulation, wound healing, and inflammation control.
It has been studied for roles in epithelial protection across skin, lung, and gastrointestinal systems.

Benefits

• Broad-spectrum defense — studied for antimicrobial activity against bacteria, viruses, and fungi
• Immune modulation — explored for balancing innate and adaptive immune responses
• Wound healing — linked to angiogenesis and tissue regeneration research
• Anti-inflammatory — studied for calming excessive inflammatory signaling
• Barrier protection — interest in skin, lung, and gut epithelial defense

Localized Effects with Nasal Spray

• Rapid uptake through the nasal mucosa
• Direct antimicrobial and immune-modulating effects in respiratory and systemic pathways
• Formulated with a specialized isotonic nasal vehicle to minimize irritation and dryness

What Researchers Use It For

• Mechanism: cationic peptide disrupting microbial membranes and signaling immune pathways
• Role in epithelial defense of skin, lung, and gastrointestinal tract
• Angiogenesis and wound-healing effects in tissue models
• Exploration in sepsis, chronic infections, and autoimmune conditions

Identity & Specs

• Sequence: [LL-37, 37 aa]
• Formula / M.W.: C215H358N64O46, ~4493 g/mol
• CAS: 221231-10-3
• Form: Sterile nasal spray solution
• Net per vial: 10 mL (~100 sprays)
• Total Content: 10 mg LL-37 per vial
• Purity: ≥99% (HPLC)
• Identity: MS-verified (per COA)
• Storage: Refrigerate 2–8 °C, protect from light

Selected Research

• PubChem entry — chemical identity:
  
  https://pubchem.ncbi.nlm.nih.gov/compound/16130166
  
• Antimicrobial and immune roles of LL-37:
  
  https://pubmed.ncbi.nlm.nih.gov/12794199/
  
• LL-37 in wound healing and angiogenesis:
  
  https://pubmed.ncbi.nlm.nih.gov/16489025/
  
• Role in lung and epithelial defense:
  
  https://pubmed.ncbi.nlm.nih.gov/17923416/
  
• LL-37 immune modulation overview:
  
  https://pubmed.ncbi.nlm.nih.gov/20193060/
  

⚠️ Disclaimer

• This product is intended for laboratory research use only.

• Not for human or veterinary use.

• Not approved for diagnostic, therapeutic, or medical applications.

• Handle using appropriate laboratory safety procedures and personal protective equipment.