IGF-1 LR3 — 1 mg

IGF-1 LR3 (Long Arg3 Insulin-like Growth Factor-1) is a synthetic analog of IGF-1 engineered with an arginine substitution at position 3 and an extended N-terminal peptide sequence. These modifications give it a longer half-life and enhanced bioactivity compared to native IGF-1. It is studied for its effects on muscle hypertrophy, tissue repair, and metabolic signaling.

Benefits

• Muscle growth — studied for stimulating muscle hypertrophy via IGF-1 receptor activation.
• Recovery — explored for enhancing tissue repair and regeneration after injury.
• Metabolic signaling — linked to insulin sensitivity and glucose uptake pathways.
• Anti-aging research — interest in supporting cellular repair and longevity pathways.
• Extended half-life — longer activity window than native IGF-1, improving research utility.

What researchers look at

• IGF-1 receptor binding and downstream PI3K/Akt/mTOR activation.
• Effects on skeletal muscle growth and regeneration.
• Role in insulin signaling and metabolic homeostasis.
• Comparison of LR3 analog vs native IGF-1 in stability and activity.

Quick Specs

• Form: Lyophilized peptide
• Net per vial: 1 mg
• Purity: ≥99% (HPLC)
• Identity: MS-verified (per COA)
• Storage: 2–8 °C, protect from light

Identity Basics

• Sequence: MFPAMPLLSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Formula / M.W.: C400H625N111O115S9, ~9117 g/mol
• CAS: 946870-92-4

Selected Research

• PubChem entry — chemical identity:
  
  https://pubchem.ncbi.nlm.nih.gov/compound/16132212
  
• IGF-1 and muscle hypertrophy research:
  
  https://pubmed.ncbi.nlm.nih.gov/10865724/
  
• LR3 analog extended half-life study:
  
  https://pubmed.ncbi.nlm.nih.gov/17031597/
  
• IGF-1 in metabolic and repair pathways:
  
  https://pubmed.ncbi.nlm.nih.gov/12138094/
  

⚠️ Disclaimer

• This product is intended for laboratory research use only.

• Not for human or veterinary use.

• Not approved for diagnostic, therapeutic, or medical applications.

• Handle using appropriate laboratory safety procedures and personal protective equipment.