Free shipping over $200 β€’ Xpresspost 1–2 business days β€’ Orders before 5 pm ET ship the same day

TB-500 β€” 10mg

$69.99

  • This product isΒ intended for laboratory research use only.

  • Not for human or veterinary use.

  • Not approved forΒ diagnostic, therapeutic, or medical applications.

  • Handle using appropriate laboratory safety procedures and personal protective equipment.

Xpresspost Shipping β€” Orders before 5 pm eastern standard time ship the same business day. Most Canadian addresses deliver in 1–2 business days.
Product Image

TB-500 β€” 10mg

  • Batch: TB001
  • Avg. Purity: 99.484%
  • Avg. Mass: 10.67 mg
  • Result Date: 24/09/2025
View full report
SKU: TB-500 (tb4) - 10mg Categories: ,

Description

TB-500, also known as Thymosin Beta-4, is a naturally occurring 43-amino-acid peptide studied for its role in wound healing, angiogenesis, and tissue regeneration. It supports cellular migration and structural repair through its interactions with actin, a key protein in cell movement and organization.

Benefits

  • Wound healing β€” studied for promoting faster tissue recovery and repair.
  • Angiogenesis β€” linked to formation of new blood vessels in healing tissue.
  • Cell migration β€” supports actin-binding and cytoskeletal reorganization.
  • Inflammation control β€” explored for balancing inflammatory and repair responses.
  • Tissue resilience β€” interest in regeneration of skin, muscle, tendon, and heart tissue.

What researchers look at

  • Mechanism: actin-sequestering peptide influencing cell motility and repair.
  • Preclinical studies in corneal, cardiac, and dermal wound healing models.
  • Angiogenesis pathways involving VEGF and integrin expression.
  • Exploration for systemic and localized regenerative applications.

Quick Specs

  • Form: Lyophilized peptide
  • Net per vial: 10 mg
  • Purity: β‰₯99% (HPLC)
  • Identity: MS-verified (per COA)
  • Storage: 2–8 Β°C, protect from light

Identity Basics

  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
  • Formula / M.W.: C212H350N56O78S, ~4963 g/mol
  • CAS: 77591-33-4

Selected Research

  • Tissue repair and wound healing activity: https://pubmed.ncbi.nlm.nih.gov/11336780/
  • Angiogenesis and cell migration studies: https://pubmed.ncbi.nlm.nih.gov/12794199/
  • Regenerative applications and actin-binding: https://pubmed.ncbi.nlm.nih.gov/16432249/
  • Cardiac and corneal healing models: https://pubmed.ncbi.nlm.nih.gov/19433835/

⚠️ Disclaimer

  • This product isΒ intended for laboratory research use only.

  • Not for human or veterinary use.

  • Not approved forΒ diagnostic, therapeutic, or medical applications.

  • Handle using appropriate laboratory safety procedures and personal protective equipment.

Additional information

Weight .006 g
Dimensions 1.7 × 1.7 × 3.8 in
Dose (mg)

10 mg

Pack Size

10-Pack, Single Vial