Description
LL-37 is a human cathelicidin-derived antimicrobial peptide. It is studied for its broad-spectrum activity against bacteria, viruses, and fungi, as well as its roles in immune modulation, wound repair, and inflammation balance.
Benefits
- Broad-spectrum defense — studied for antimicrobial activity against bacteria, viruses, and fungi.
- Immune modulation — explored for balancing innate and adaptive immune responses.
- Wound healing — linked to angiogenesis and tissue regeneration research.
- Anti-inflammatory — studied for calming excessive inflammatory signaling.
- Barrier protection — interest in skin, lung, and gut epithelial defense.
What Researchers Look At
- Mechanism: cationic peptide disrupting microbial membranes and signaling immune pathways.
- Role in epithelial defense of skin, lung, and gastrointestinal tract.
- Angiogenesis and wound-healing effects in tissue models.
- Exploration in sepsis, chronic infections, and autoimmune conditions.
Quick Specs
- Form: Lyophilized peptide
- Net per vial: 10 mg
- Purity: ≥99% (HPLC)
- Identity: MS-verified (per COA)
- Storage: 2–8 °C, protect from light
Identity Basics
- Sequence: [LL-37, 37 aa]
- Formula / M.W.: C215H358N64O46, ~4493 g/mol
- CAS: 221231-10-3
Selected Research
- PubChem entry — chemical identity:
https://pubchem.ncbi.nlm.nih.gov/compound/16130166
- Antimicrobial and immune roles of LL-37:
https://pubmed.ncbi.nlm.nih.gov/12794199/
- LL-37 in wound healing and angiogenesis:
https://pubmed.ncbi.nlm.nih.gov/16489025/
- Role in lung and epithelial defense:
https://pubmed.ncbi.nlm.nih.gov/17923416/
- LL-37 immune modulation overview:
https://pubmed.ncbi.nlm.nih.gov/20193060/
⚠️ Disclaimer
-
This product is intended for laboratory research use only.
-
Not for human or veterinary use.
-
Not approved for diagnostic, therapeutic, or medical applications.
-
Handle using appropriate laboratory safety procedures and personal protective equipment.
