Description
TB-500, also known as Thymosin Beta-4, is a naturally occurring 43-amino-acid peptide studied for its role in wound healing, angiogenesis, and tissue regeneration. It supports cellular migration and structural repair through its interactions with actin, a key protein in cell movement and organization.
Benefits
- Wound healing — studied for promoting faster tissue recovery and repair.
- Angiogenesis — linked to formation of new blood vessels in healing tissue.
- Cell migration — supports actin-binding and cytoskeletal reorganization.
- Inflammation control — explored for balancing inflammatory and repair responses.
- Tissue resilience — interest in regeneration of skin, muscle, tendon, and heart tissue.
What researchers look at
- Mechanism: actin-sequestering peptide influencing cell motility and repair.
- Preclinical studies in corneal, cardiac, and dermal wound healing models.
- Angiogenesis pathways involving VEGF and integrin expression.
- Exploration for systemic and localized regenerative applications.
Quick Specs
- Form: Lyophilized peptide
- Net per vial: 10 mg
- Purity: ≥99% (HPLC)
- Identity: MS-verified (per COA)
- Storage: 2–8 °C, protect from light
Identity Basics
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
- Formula / M.W.: C212H350N56O78S, ~4963 g/mol
- CAS: 77591-33-4
Selected Research
- Tissue repair and wound healing activity: https://pubmed.ncbi.nlm.nih.gov/11336780/
- Angiogenesis and cell migration studies: https://pubmed.ncbi.nlm.nih.gov/12794199/
- Regenerative applications and actin-binding: https://pubmed.ncbi.nlm.nih.gov/16432249/
- Cardiac and corneal healing models: https://pubmed.ncbi.nlm.nih.gov/19433835/
⚠️ Disclaimer
-
This product is intended for laboratory research use only.
-
Not for human or veterinary use.
-
Not approved for diagnostic, therapeutic, or medical applications.
-
Handle using appropriate laboratory safety procedures and personal protective equipment.
