Description
KLOW is a four-component lyophilized research blend combining four peptides studied in tissue repair, dermal biology, and inflammation research literature: BPC-157 (Body Protection Compound-157, a synthetic 15-amino-acid gastric peptide), TB-500 / Thymosin Beta-4 (a 43-amino-acid β-thymosin family peptide), GHK-Cu (Copper Tripeptide-1, the glycyl-L-histidyl-L-lysine copper complex), and KPV (Lys-Pro-Val, an α-MSH-derived anti-inflammatory tripeptide). The blend pairs two tissue regenerative peptides with a copper-binding fibroblast activator and an anti-inflammatory tripeptide for comparative pharmacology research across angiogenesis, fibroblast biology, collagen synthesis, and inflammation pathway endpoints. KLOW is intended as a comprehensive research blend for investigators studying multi-pathway interactions in dermal, connective tissue, and inflammation preclinical models.
Benefits (Research Focus)
• Multi-pathway research — studied for paired investigation across four distinct peptide signaling pathways in a single research blend
• Tissue repair pathways — investigated via BPC-157 and TB-500 components for angiogenesis and fibroblast migration endpoints
• Copper-peptide research — explored via GHK-Cu for fibroblast activation, collagen synthesis, and dermal matrix remodeling
• Anti-inflammatory signaling — examined via KPV (α-MSH–derived tripeptide) for NF-κB pathway and inflammatory cytokine modulation
• Comparative pharmacology — researched for paired vs single-compound endpoint differences across tissue repair, dermal, and inflammation models
What Researchers Look At
• Fibroblast activation, collagen Type I/III synthesis, and dermal matrix protein expression
• Angiogenesis markers (VEGF, integrins) and endothelial cell migration assays
• NF-κB pathway activity and inflammatory cytokine (TNF-α, IL-6) modulation
• Wound closure rates and dermal repair endpoints in preclinical models
• Multi-component blend pharmacology versus single-peptide administration
Quick Specs
• Form: Lyophilized white-to-blue powder (color from GHK-Cu copper complex)
• BPC-157: [add mg per COA]
• TB-500: [add mg per COA]
• GHK-Cu: [add mg per COA]
• KPV: [add mg per COA]
• Total Peptide Content: [80 mg or 100 mg per vial — confirm against COA]
• Quantity: 1 vial
• Appearance: Pale blue to white lyophilizate
• Reconstitution: Bacteriostatic or sterile water (added by the end researcher)
• Purity: ≥99% by HPLC (per component)
• Identity: MS-verified (per COA)
• Storage: Protect from light
Identity Basics
• Compound 1: BPC-157 (Body Protection Compound-157)
• Class: Synthetic pentadecapeptide; gastric juice–derived tissue regenerative peptide
• Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (15 amino acids)
• Formula / M.W.: C62H98N16O22, ~1419.55 g/mol
• CAS: 137525-51-0
• Compound 2: TB-500 (Thymosin Beta-4 / Tβ4)
• Class: β-thymosin family; G-actin sequestering peptide; 43 amino acids
• Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES
• Formula / M.W.: C212H350N56O78S, ~4963.44 g/mol
• CAS: 77591-33-4
• Compound 3: GHK-Cu (Copper Tripeptide-1)
• Class: Copper-binding tripeptide; glycyl-L-histidyl-L-lysine copper(II) complex
• Sequence: Gly-His-Lys (with Cu²⁺ coordination)
• Formula / M.W.: C14H22CuN6O4, ~402.91 g/mol (copper complex)
• CAS: 49557-75-7
• Compound 4: KPV (Lys-Pro-Val)
• Class: α-MSH–derived tripeptide; anti-inflammatory signaling peptide
• Sequence: Lys-Pro-Val (KPV)
• Formula / M.W.: C16H30N4O4, ~342.43 g/mol
• CAS: 67727-97-3
⚠️ Disclaimer
-
This product is intended for laboratory research use only.
-
Not for human or veterinary use.
-
Not approved for diagnostic, therapeutic, or medical applications.
-
Handle using appropriate laboratory safety procedures and personal protective equipment.
COA Verification Notice: Even if the vial label or product image states a certain concentration, always go by the COA for the true verified value. We reference the COA to determine the verified concentration and purity of each product, regardless of what the label or product image indicates.
