FOXO4-DRI — 10 mg

FOXO4-DRI is a synthetic D-retro-inverso peptide designed to disrupt the FOXO4–p53 interaction. It is studied for its senolytic properties — selectively targeting senescent cells — with the aim of supporting tissue regeneration, organ health, and longevity research.

Benefits

• Cellular renewal — studied for selectively clearing senescent ‘zombie’ cells in models.
• Tissue rejuvenation — linked to improved organ function and resilience in aging research.
• Longevity science — explored for its role in lifespan and healthspan extension studies.
• Skin and hair health — animal data show improved coat condition after senescent cell clearance.
• Joint and cartilage support — lab studies suggest selective removal of senescent chondrocytes.

What researchers look at

• Mechanism: blocks FOXO4–p53 binding, triggering apoptosis in senescent cells.
• Animal models: improved kidney function, fur density, and activity levels in aged mice.
• Molecular effects: reduction of p16 and IL-6 markers tied to cellular senescence.
• Structural biology: evidence for targeting the p53 transactivation domain surface.

Quick Specs

• Form: Lyophilized peptide
• Net per vial: 10 mg
• Purity: ≥99% (HPLC)
• Identity: MS-verified (per COA)
• Storage: 2–8 °C, protect from light

Identity Basics

• Type: D-retro-inverso peptide (FOXO4-derived)
• Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP (all D-amino acids, retro-inverso)
• Formula / M.W.: ~C228H388N86O64, ~5358 g/mol
• CAS: 2460055-10-9

Selected Research

• Cell (2017) — FOXO4-DRI senolytic mouse study:
  
  https://pmc.ncbi.nlm.nih.gov/articles/PMC5556182/
  
• Frontiers in Bioengineering & Biotechnology (2021) — selective removal of senescent chondrocytes:
  
  https://www.frontiersin.org/articles/10.3389/fbioe.2021.677576/full
  
• Nature Communications (2025) — p53 transactivation domain target study:
  
  https://www.nature.com/articles/s41467-025-60844-9
  

⚠️ Disclaimer

• This product is intended for laboratory research use only.

• Not for human or veterinary use.

• Not approved for diagnostic, therapeutic, or medical applications.

• Handle using appropriate laboratory safety procedures and personal protective equipment.